The corpus record — Pali
vīriyasamādhipadhānasaṅkhārasamannāgataṁ
viriyasamadhipadhanasankharasamannagat
Every figure on this page is a live query of the corpus record.
Where it lives
- Digha Nikaya 2 · 0.14/10k
What it meant
No PTS Pali–English Dictionary entry is recorded for this lemma.
In the wild
- vīriyasamādhipadhānasaṅkhārasamannāgataṁ Digha Nikaya 26 (dn26:28.5)
- Vīriyasamādhipadhānasaṅkhārasamannāgataṁ Digha Nikaya 33 (dn33:1.11.17)
Downloads
Word record (JSON)·Concordance (CSV)·Frequencies (CSV)·Cite (BibTeX)
CC BY 4.0 with receipt attribution — every file carries its license line. What is exportable
Pali text and translations from SuttaCentral (Bilara), dedicated to the public domain (CC0). PTS Pali–English Dictionary entries, public domain.