The corpus record — Pali
Vīriyasamādhippadhānasaṅkhārasamannāgataṁ
viriyasamadhippadhanasankharasamannagat
Every figure on this page is a live query of the corpus record.
Where it lives
- Digha Nikaya 1 · 0.07/10k
What it meant
This reads as a proper name — a river, a person, a place — held only because the corpus attests it. It stands outside the library's subject, the vocabulary of the soul, so no lexicon entry is recorded.
In the wild
- Vīriyasamādhippadhānasaṅkhārasamannāgataṁ Digha Nikaya 18 (dn18:22.6)
Downloads
Word record (JSON)·Concordance (CSV)·Frequencies (CSV)·Cite (BibTeX)
CC BY 4.0 with receipt attribution — every file carries its license line. What is exportable
Pali text and translations from SuttaCentral (Bilara), dedicated to the public domain (CC0). PTS Pali–English Dictionary entries, public domain.