LOGOI

The corpus record — Pali

Vīriyasamādhippadhānasaṅkhārasamannāgataṁ

viriyasamadhippadhanasankharasamannagat

Every figure on this page is a live query of the corpus record.

Where it lives

What it meant

This reads as a proper name — a river, a person, a place — held only because the corpus attests it. It stands outside the library's subject, the vocabulary of the soul, so no lexicon entry is recorded.

In the wild

Downloads

CC BY 4.0 with receipt attribution — every file carries its license line. What is exportable

Pali text and translations from SuttaCentral (Bilara), dedicated to the public domain (CC0). PTS Pali–English Dictionary entries, public domain.